Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries) Uniprot P01130 272-353 |
Domain d1n7da4: 1n7d A:643-693 [80239] Other proteins in same PDB: d1n7da1, d1n7da5, d1n7da6, d1n7da7, d1n7da8, d1n7da9, d1n7daa modules A, B, and C in the whole receptor structure context complexed with ca, keg |
PDB Entry: 1n7d (more details), 3.7 Å
SCOPe Domain Sequences for d1n7da4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n7da4 g.3.11.1 (A:643-693) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} vnwcerttlsnggcqylclpapqinphspkftcacpdgmllardmrsclte
Timeline for d1n7da4: