Lineage for d1n7da3 (1n7d A:333-376)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1062283Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1062284Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1062513Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)
  7. 1062514Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries)
    Uniprot P01130 272-353
  8. 1062526Domain d1n7da3: 1n7d A:333-376 [80238]
    Other proteins in same PDB: d1n7da1, d1n7da5, d1n7da6, d1n7da7, d1n7da8, d1n7da9, d1n7daa
    modules A, B, and C in the whole receptor structure context
    complexed with ca, keg

Details for d1n7da3

PDB Entry: 1n7d (more details), 3.7 Å

PDB Description: extracellular domain of the ldl receptor
PDB Compounds: (A:) low-density lipoprotein receptor

SCOPe Domain Sequences for d1n7da3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7da3 g.3.11.1 (A:333-376) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}
didecqdpdtcsqlcvnleggykcqceegfqldphtkackavgs

SCOPe Domain Coordinates for d1n7da3:

Click to download the PDB-style file with coordinates for d1n7da3.
(The format of our PDB-style files is described here.)

Timeline for d1n7da3: