SCOPe 2.07: Domain d1n73e2: 1n73 E:163-218

Lineage for d1n73e2 (1n73 E:163-218)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen beta chain [88892] (4 species)

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [88897] (2 PDB entries)

8. Domain d1n73e2: 1n73 E:163-218 [80221]
   Other proteins in same PDB: d1n73a_, d1n73b1, d1n73c1, d1n73c2, d1n73d_, d1n73e1, d1n73f1, d1n73f2
   coiled-coil region only
   complexed with ca, nag

Details for d1n73e2

PDB Entry: 1n73, 2.9 Å

PDB Description: fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his- arg-pro-amide

PDB Compounds: (E:) Fibrin beta chain

SCOPe Domain Sequences for d1n73e2:

Sequence; same for both SEQRES and ATOM records:

>d1n73e2 h.1.8.1 (E:163-218) Fibrinogen beta chain {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
aqkeienrykevkiriestvagslrsmksvlehlrakmqrmeeaiktqkelcsapc

Timeline for d1n73e2:

• d1n73e2 first appeared in SCOP 1.63
  
• d1n73e2 appears in SCOPe 2.06
  
• d1n73e2 appears in the current release, SCOPe 2.08