Lineage for d1n72a1 (1n72 A:719-832)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316814Family a.29.2.1: Bromodomain [47371] (6 protein domains)
  6. 2316873Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)
  7. 2316874Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries)
  8. 2316880Domain d1n72a1: 1n72 A:719-832 [80213]
    Other proteins in same PDB: d1n72a2

Details for d1n72a1

PDB Entry: 1n72 (more details)

PDB Description: Structure and Ligand of a Histone Acetyltransferase Bromodomain
PDB Compounds: (A:) histone acetyltransferase

SCOPe Domain Sequences for d1n72a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n72a1 a.29.2.1 (A:719-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
skeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlk
nryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

SCOPe Domain Coordinates for d1n72a1:

Click to download the PDB-style file with coordinates for d1n72a1.
(The format of our PDB-style files is described here.)

Timeline for d1n72a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n72a2