Lineage for d1n6ql2 (1n6q L:108-211)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454374Domain d1n6ql2: 1n6q L:108-211 [80210]
    Other proteins in same PDB: d1n6qa1, d1n6qa2, d1n6qb_, d1n6qh1, d1n6qh2, d1n6ql1
    part of Fab 28 against HIV-1 RT

Details for d1n6ql2

PDB Entry: 1n6q (more details), 3 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp- terminated dna (complex n)

SCOP Domain Sequences for d1n6ql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ql2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1n6ql2:

Click to download the PDB-style file with coordinates for d1n6ql2.
(The format of our PDB-style files is described here.)

Timeline for d1n6ql2: