SCOP 1.65: Domain d1n6qh2: 1n6q H:124-225

Lineage for d1n6qh2 (1n6q H:124-225)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)

8. Domain d1n6qh2: 1n6q H:124-225 [80208]
   Other proteins in same PDB: d1n6qa1, d1n6qa2, d1n6qb_, d1n6qh1, d1n6ql1, d1n6ql2
   part of Fab 28 against HIV-1 RT
   complexed with atm, mg, mrg; mutant

Details for d1n6qh2

PDB Entry: 1n6q, 3 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp- terminated dna (complex n)

SCOP Domain Sequences for d1n6qh2:

Sequence; same for both SEQRES and ATOM records:

>d1n6qh2 b.1.1.2 (H:124-225) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpadc

Timeline for d1n6qh2:

• d1n6qh2 first appeared in SCOP 1.63
  
• d1n6qh2 appears in SCOP 1.67
  
• d1n6qh2 appears in the current release, SCOPe 2.08