Lineage for d1n6qb_ (1n6q B:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517941Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 517942Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 518049Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 518050Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 518051Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (78 PDB entries)
  8. 518202Domain d1n6qb_: 1n6q B: [80206]
    Other proteins in same PDB: d1n6qa1, d1n6qh1, d1n6qh2, d1n6ql1, d1n6ql2

Details for d1n6qb_

PDB Entry: 1n6q (more details), 3 Å

PDB Description: HIV-1 Reverse Transcriptase Crosslinked to pre-translocation AZTMP-terminated DNA (complex N)

SCOP Domain Sequences for d1n6qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6qb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOP Domain Coordinates for d1n6qb_:

Click to download the PDB-style file with coordinates for d1n6qb_.
(The format of our PDB-style files is described here.)

Timeline for d1n6qb_: