Lineage for d1n6qa2 (1n6q A:1-429)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743176Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 743177Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 743178Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (90 PDB entries)
  8. 743323Domain d1n6qa2: 1n6q A:1-429 [80205]
    Other proteins in same PDB: d1n6qa1, d1n6qh1, d1n6qh2, d1n6ql1, d1n6ql2
    complexed with atm, mg, mrg; mutant

Details for d1n6qa2

PDB Entry: 1n6q (more details), 3 Å

PDB Description: HIV-1 Reverse Transcriptase Crosslinked to pre-translocation AZTMP-terminated DNA (complex N)
PDB Compounds: (A:) reverse transcriptase

SCOP Domain Sequences for d1n6qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6qa2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOP Domain Coordinates for d1n6qa2:

Click to download the PDB-style file with coordinates for d1n6qa2.
(The format of our PDB-style files is described here.)

Timeline for d1n6qa2: