SCOP 1.65: Domain d1n6qa2: 1n6q A:1-429

Lineage for d1n6qa2 (1n6q A:1-429)

1. Root: SCOP 1.65

2. Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (63 PDB entries)

8. Domain d1n6qa2: 1n6q A:1-429 [80205]
   Other proteins in same PDB: d1n6qa1, d1n6qh1, d1n6qh2, d1n6ql1, d1n6ql2
   complexed with atm, mg, mrg; mutant

Details for d1n6qa2

PDB Entry: 1n6q, 3 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp- terminated dna (complex n)

SCOP Domain Sequences for d1n6qa2:

Sequence; same for both SEQRES and ATOM records:

>d1n6qa2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d1n6qa2:

• d1n6qa2 first appeared in SCOP 1.63
  
• d1n6qa2 appears in SCOP 1.67
  
• d1n6qa2 appears in the current release, SCOPe 2.08