| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Rab5a [82399] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82400] (11 PDB entries) |
| Domain d1n6oa_: 1n6o A: [80202] complexed with bme, gnp, mg; mutant |
PDB Entry: 1n6o (more details), 1.8 Å
SCOP Domain Sequences for d1n6oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6oa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens)}
gnkicqfklvllgeskvgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw
dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk
adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpkn
Timeline for d1n6oa_: