Lineage for d1n6oa_ (1n6o A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243198Family c.37.1.8: G proteins [52592] (31 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 243401Protein Rab5a [82399] (1 species)
  7. 243402Species Human (Homo sapiens) [TaxId:9606] [82400] (8 PDB entries)
  8. 243410Domain d1n6oa_: 1n6o A: [80202]
    complexed with bme, gnp, mg; mutant

Details for d1n6oa_

PDB Entry: 1n6o (more details), 1.8 Å

PDB Description: crystal structure of human rab5a a30k mutant complex with gppnhp

SCOP Domain Sequences for d1n6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6oa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens)}
gnkicqfklvllgeskvgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw
dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk
adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpkn

SCOP Domain Coordinates for d1n6oa_:

Click to download the PDB-style file with coordinates for d1n6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1n6oa_: