SCOPe 2.01: Domain d1n6la_: 1n6l A:

Lineage for d1n6la_ (1n6l A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab5a [82399] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82400] (12 PDB entries)
   Uniprot P20339 18-182

8. Domain d1n6la_: 1n6l A: [80200]
   complexed with bme, gtp, mg; mutant

Details for d1n6la_

PDB Entry: 1n6l, 1.6 Å

PDB Description: crystal structure of human rab5a a30p mutant complex with gtp

PDB Compounds: (A:) Ras-related protein Rab-5A

SCOPe Domain Sequences for d1n6la_:

Sequence; same for both SEQRES and ATOM records:

>d1n6la_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}
gnkicqfklvllgespvgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw
dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk
adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklp

Timeline for d1n6la_:

• d1n6la_ first appeared in SCOP 1.63
  
• d1n6la_ appears in SCOP 1.75
  
• d1n6la_ appears in SCOPe 2.02
  
• d1n6la_ appears in the current release, SCOPe 2.08