Lineage for d1n6ka_ (1n6k A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475628Protein Rab5a [82399] (1 species)
  7. 2475629Species Human (Homo sapiens) [TaxId:9606] [82400] (12 PDB entries)
    Uniprot P20339 18-182
  8. 2475634Domain d1n6ka_: 1n6k A: [80199]
    complexed with af3, bme, gdp, mg; mutant

Details for d1n6ka_

PDB Entry: 1n6k (more details), 1.55 Å

PDB Description: crystal structure of human rab5a a30p mutant complex with gdp and aluminum fluoride
PDB Compounds: (A:) Ras-related protein Rab-5A

SCOPe Domain Sequences for d1n6ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ka_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}
gnkicqfklvllgespvgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw
dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk
adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakkl

SCOPe Domain Coordinates for d1n6ka_:

Click to download the PDB-style file with coordinates for d1n6ka_.
(The format of our PDB-style files is described here.)

Timeline for d1n6ka_: