Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab5a [82399] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82400] (12 PDB entries) Uniprot P20339 18-182 |
Domain d1n6ka_: 1n6k A: [80199] complexed with af3, bme, gdp, mg; mutant |
PDB Entry: 1n6k (more details), 1.55 Å
SCOPe Domain Sequences for d1n6ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6ka_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} gnkicqfklvllgespvgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiw dtagqeryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnk adlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakkl
Timeline for d1n6ka_: