Lineage for d1n6ff3 (1n6f F:320-679)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565655Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 565847Superfamily b.69.9: Tricorn protease domain 2 [69322] (1 family) (S)
    distorted 7-bladed beta-propeller fold; possibly related to the N-terminal domain of tricorn protease (a 6-bladed beta-propeller)
  5. 565848Family b.69.9.1: Tricorn protease domain 2 [69323] (1 protein)
  6. 565849Protein Tricorn protease domain 2 [69324] (1 species)
  7. 565850Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69325] (4 PDB entries)
  8. 565868Domain d1n6ff3: 1n6f F:320-679 [80195]
    Other proteins in same PDB: d1n6fa1, d1n6fa2, d1n6fa4, d1n6fb1, d1n6fb2, d1n6fb4, d1n6fc1, d1n6fc2, d1n6fc4, d1n6fd1, d1n6fd2, d1n6fd4, d1n6fe1, d1n6fe2, d1n6fe4, d1n6ff1, d1n6ff2, d1n6ff4
    complexed with dkt

Details for d1n6ff3

PDB Entry: 1n6f (more details), 2.7 Å

PDB Description: tricorn protease in complex with Z-Phe-diketo-Arg-Glu-Phe

SCOP Domain Sequences for d1n6ff3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ff3 b.69.9.1 (F:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum}
sipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafih
gtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkpt
viersreamitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattensh
dyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsm
tseageydlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvl
lkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplv

SCOP Domain Coordinates for d1n6ff3:

Click to download the PDB-style file with coordinates for d1n6ff3.
(The format of our PDB-style files is described here.)

Timeline for d1n6ff3: