Lineage for d1n6fe2 (1n6f E:39-319)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 301738Fold b.68: 6-bladed beta-propeller [50938] (8 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 301905Superfamily b.68.7: Tricorn protease N-terminal domain [69304] (1 family) (S)
    possibly related to the second domain of tricorn protease (a distorted 7-bladed beta-propeller)
  5. 301906Family b.68.7.1: Tricorn protease N-terminal domain [69305] (1 protein)
  6. 301907Protein Tricorn protease N-terminal domain [69306] (1 species)
  7. 301908Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69307] (4 PDB entries)
  8. 301925Domain d1n6fe2: 1n6f E:39-319 [80190]
    Other proteins in same PDB: d1n6fa1, d1n6fa3, d1n6fa4, d1n6fb1, d1n6fb3, d1n6fb4, d1n6fc1, d1n6fc3, d1n6fc4, d1n6fd1, d1n6fd3, d1n6fd4, d1n6fe1, d1n6fe3, d1n6fe4, d1n6ff1, d1n6ff3, d1n6ff4

Details for d1n6fe2

PDB Entry: 1n6f (more details), 2.7 Å

PDB Description: tricorn protease in complex with Z-Phe-diketo-Arg-Glu-Phe

SCOP Domain Sequences for d1n6fe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6fe2 b.68.7.1 (E:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum}
mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
ntdgrrilfskggsiyifnpdtekiekieigdlespedrii

SCOP Domain Coordinates for d1n6fe2:

Click to download the PDB-style file with coordinates for d1n6fe2.
(The format of our PDB-style files is described here.)

Timeline for d1n6fe2: