SCOP 1.69: Domain d1n6fe1: 1n6f E:763-853

Lineage for d1n6fe1 (1n6f E:763-853)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.3: Tail specific protease PDZ domain [68933] (2 proteins)

6. Protein Tricorn protease [69253] (1 species)

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69254] (4 PDB entries)

8. Domain d1n6fe1: 1n6f E:763-853 [80189]
   Other proteins in same PDB: d1n6fa2, d1n6fa3, d1n6fa4, d1n6fb2, d1n6fb3, d1n6fb4, d1n6fc2, d1n6fc3, d1n6fc4, d1n6fd2, d1n6fd3, d1n6fd4, d1n6fe2, d1n6fe3, d1n6fe4, d1n6ff2, d1n6ff3, d1n6ff4

Details for d1n6fe1

PDB Entry: 1n6f, 2.7 Å

PDB Description: tricorn protease in complex with Z-Phe-diketo-Arg-Glu-Phe

SCOP Domain Sequences for d1n6fe1:

Sequence; same for both SEQRES and ATOM records:

>d1n6fe1 b.36.1.3 (E:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum}
griacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgagsniy
rvlsekagtsarirlsgkggdkrdlmidild

Timeline for d1n6fe1:

• d1n6fe1 first appeared in SCOP 1.63
  
• d1n6fe1 appears in SCOP 1.67
  
• d1n6fe1 appears in SCOP 1.71
  
• d1n6fe1 appears in the current release, SCOPe 2.08