Class b: All beta proteins [48724] (141 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (10 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.7: Tricorn protease N-terminal domain [69304] (1 family) possibly related to the second domain of tricorn protease (a distorted 7-bladed beta-propeller) |
Family b.68.7.1: Tricorn protease N-terminal domain [69305] (1 protein) |
Protein Tricorn protease N-terminal domain [69306] (1 species) |
Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69307] (4 PDB entries) |
Domain d1n6fd2: 1n6f D:39-319 [80186] Other proteins in same PDB: d1n6fa1, d1n6fa3, d1n6fa4, d1n6fb1, d1n6fb3, d1n6fb4, d1n6fc1, d1n6fc3, d1n6fc4, d1n6fd1, d1n6fd3, d1n6fd4, d1n6fe1, d1n6fe3, d1n6fe4, d1n6ff1, d1n6ff3, d1n6ff4 |
PDB Entry: 1n6f (more details), 2.7 Å
SCOP Domain Sequences for d1n6fd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6fd2 b.68.7.1 (D:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum} mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl ntdgrrilfskggsiyifnpdtekiekieigdlespedrii
Timeline for d1n6fd2: