Class b: All beta proteins [48724] (174 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.3: Tail specific protease PDZ domain [68933] (2 proteins) |
Protein Tricorn protease [69253] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [69254] (4 PDB entries) |
Domain d1n6fd1: 1n6f D:763-853 [80185] Other proteins in same PDB: d1n6fa2, d1n6fa3, d1n6fa4, d1n6fb2, d1n6fb3, d1n6fb4, d1n6fc2, d1n6fc3, d1n6fc4, d1n6fd2, d1n6fd3, d1n6fd4, d1n6fe2, d1n6fe3, d1n6fe4, d1n6ff2, d1n6ff3, d1n6ff4 complexed with dkt |
PDB Entry: 1n6f (more details), 2.7 Å
SCOPe Domain Sequences for d1n6fd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6fd1 b.36.1.3 (D:763-853) Tricorn protease {Thermoplasma acidophilum [TaxId: 2303]} griacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgagsniy rvlsekagtsarirlsgkggdkrdlmidild
Timeline for d1n6fd1: