Lineage for d1n6ei1 (1n6e I:763-853)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228215Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 228216Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 228270Family b.36.1.3: Tail specific protease PDZ domain [68933] (2 proteins)
  6. 228277Protein Tricorn protease [69253] (1 species)
  7. 228278Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69254] (4 PDB entries)
  8. 228289Domain d1n6ei1: 1n6e I:763-853 [80165]
    Other proteins in same PDB: d1n6ea2, d1n6ea3, d1n6ea4, d1n6ec2, d1n6ec3, d1n6ec4, d1n6ee2, d1n6ee3, d1n6ee4, d1n6eg2, d1n6eg3, d1n6eg4, d1n6ei2, d1n6ei3, d1n6ei4, d1n6ek2, d1n6ek3, d1n6ek4

Details for d1n6ei1

PDB Entry: 1n6e (more details), 2.6 Å

PDB Description: tricorn protease in complex with a tridecapeptide chloromethyl ketone derivative

SCOP Domain Sequences for d1n6ei1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ei1 b.36.1.3 (I:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum}
griacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgagsniy
rvlsekagtsarirlsgkggdkrdlmidild

SCOP Domain Coordinates for d1n6ei1:

Click to download the PDB-style file with coordinates for d1n6ei1.
(The format of our PDB-style files is described here.)

Timeline for d1n6ei1: