Lineage for d1n6eg4 (1n6e G:680-762,G:854-1061)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240584Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 240585Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 240603Family c.14.1.2: Tail specific protease, catalytic domain [52100] (3 proteins)
    includes N-terminal all-alpha subdomain
  6. 240613Protein Tricorn protease [69436] (1 species)
  7. 240614Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69437] (4 PDB entries)
  8. 240624Domain d1n6eg4: 1n6e G:680-762,G:854-1061 [80164]
    Other proteins in same PDB: d1n6ea1, d1n6ea2, d1n6ea3, d1n6ec1, d1n6ec2, d1n6ec3, d1n6ee1, d1n6ee2, d1n6ee3, d1n6eg1, d1n6eg2, d1n6eg3, d1n6ei1, d1n6ei2, d1n6ei3, d1n6ek1, d1n6ek2, d1n6ek3

Details for d1n6eg4

PDB Entry: 1n6e (more details), 2.6 Å

PDB Description: tricorn protease in complex with a tridecapeptide chloromethyl ketone derivative

SCOP Domain Sequences for d1n6eg4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6eg4 c.14.1.2 (G:680-762,G:854-1061) Tricorn protease {Archaeon Thermoplasma acidophilum}
ssiheeflqmydeawklardnywneavakeiseriyekyrnlvplcktrydlsnvivemq
geyrtshsyemggtftdkdpfrsXddrfiryrswveanrryvherskgtigyihipdmgm
mglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptn
svrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqp
efafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidalieelrn

SCOP Domain Coordinates for d1n6eg4:

Click to download the PDB-style file with coordinates for d1n6eg4.
(The format of our PDB-style files is described here.)

Timeline for d1n6eg4: