Lineage for d1n6ee4 (1n6e E:680-762,E:854-1061)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099514Family c.14.1.2: Tail specific protease, catalytic domain [52100] (3 protein domains)
    includes N-terminal all-alpha subdomain
  6. 2099524Protein Tricorn protease [69436] (1 species)
  7. 2099525Species Thermoplasma acidophilum [TaxId:2303] [69437] (4 PDB entries)
  8. 2099534Domain d1n6ee4: 1n6e E:680-762,E:854-1061 [80160]
    Other proteins in same PDB: d1n6ea1, d1n6ea2, d1n6ea3, d1n6ec1, d1n6ec2, d1n6ec3, d1n6ee1, d1n6ee2, d1n6ee3, d1n6eg1, d1n6eg2, d1n6eg3, d1n6ei1, d1n6ei2, d1n6ei3, d1n6ek1, d1n6ek2, d1n6ek3
    complexed with chm

Details for d1n6ee4

PDB Entry: 1n6e (more details), 2.6 Å

PDB Description: tricorn protease in complex with a tridecapeptide chloromethyl ketone derivative
PDB Compounds: (E:) tricorn protease

SCOPe Domain Sequences for d1n6ee4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ee4 c.14.1.2 (E:680-762,E:854-1061) Tricorn protease {Thermoplasma acidophilum [TaxId: 2303]}
ssiheeflqmydeawklardnywneavakeiseriyekyrnlvplcktrydlsnvivemq
geyrtshsyemggtftdkdpfrsXddrfiryrswveanrryvherskgtigyihipdmgm
mglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptn
svrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqp
efafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidalieelrn

SCOPe Domain Coordinates for d1n6ee4:

Click to download the PDB-style file with coordinates for d1n6ee4.
(The format of our PDB-style files is described here.)

Timeline for d1n6ee4: