SCOPe 2.05: Domain d1n6ee1: 1n6e E:763-853

Lineage for d1n6ee1 (1n6e E:763-853)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.3: Tail specific protease PDZ domain [68933] (2 proteins)

6. Protein Tricorn protease [69253] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [69254] (4 PDB entries)

8. Domain d1n6ee1: 1n6e E:763-853 [80157]
   Other proteins in same PDB: d1n6ea2, d1n6ea3, d1n6ea4, d1n6ec2, d1n6ec3, d1n6ec4, d1n6ee2, d1n6ee3, d1n6ee4, d1n6eg2, d1n6eg3, d1n6eg4, d1n6ei2, d1n6ei3, d1n6ei4, d1n6ek2, d1n6ek3, d1n6ek4
   complexed with chm

Details for d1n6ee1

PDB Entry: 1n6e, 2.6 Å

PDB Description: tricorn protease in complex with a tridecapeptide chloromethyl ketone derivative

PDB Compounds: (E:) tricorn protease

SCOPe Domain Sequences for d1n6ee1:

Sequence; same for both SEQRES and ATOM records:

>d1n6ee1 b.36.1.3 (E:763-853) Tricorn protease {Thermoplasma acidophilum [TaxId: 2303]}
griacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgagsniy
rvlsekagtsarirlsgkggdkrdlmidild

Timeline for d1n6ee1:

• d1n6ee1 first appeared in SCOP 1.63
  
• d1n6ee1 appears in SCOPe 2.04
  
• d1n6ee1 appears in SCOPe 2.06
  
• d1n6ee1 appears in the current release, SCOPe 2.08