Lineage for d1n6ea2 (1n6e A:39-319)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 233193Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 233344Superfamily b.68.7: Tricorn protease N-terminal domain [69304] (1 family) (S)
    possibly related to the second domain of tricorn protease (a distorted 7-bladed beta-propeller)
  5. 233345Family b.68.7.1: Tricorn protease N-terminal domain [69305] (1 protein)
  6. 233346Protein Tricorn protease N-terminal domain [69306] (1 species)
  7. 233347Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69307] (4 PDB entries)
  8. 233354Domain d1n6ea2: 1n6e A:39-319 [80150]
    Other proteins in same PDB: d1n6ea1, d1n6ea3, d1n6ea4, d1n6ec1, d1n6ec3, d1n6ec4, d1n6ee1, d1n6ee3, d1n6ee4, d1n6eg1, d1n6eg3, d1n6eg4, d1n6ei1, d1n6ei3, d1n6ei4, d1n6ek1, d1n6ek3, d1n6ek4

Details for d1n6ea2

PDB Entry: 1n6e (more details), 2.6 Å

PDB Description: tricorn protease in complex with a tridecapeptide chloromethyl ketone derivative

SCOP Domain Sequences for d1n6ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ea2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum}
mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
ntdgrrilfskggsiyifnpdtekiekieigdlespedrii

SCOP Domain Coordinates for d1n6ea2:

Click to download the PDB-style file with coordinates for d1n6ea2.
(The format of our PDB-style files is described here.)

Timeline for d1n6ea2: