SCOP 1.65: Domain d1n6df1: 1n6d F:763-853

Lineage for d1n6df1 (1n6d F:763-853)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.3: Tail specific protease PDZ domain [68933] (2 proteins)

6. Protein Tricorn protease [69253] (1 species)

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69254] (4 PDB entries)

8. Domain d1n6df1: 1n6d F:763-853 [80145]
   Other proteins in same PDB: d1n6da2, d1n6da3, d1n6da4, d1n6db2, d1n6db3, d1n6db4, d1n6dc2, d1n6dc3, d1n6dc4, d1n6dd2, d1n6dd3, d1n6dd4, d1n6de2, d1n6de3, d1n6de4, d1n6df2, d1n6df3, d1n6df4
   complexed with chm, d10

Details for d1n6df1

PDB Entry: 1n6d, 2.8 Å

PDB Description: Tricorn protease in complex with tetrapeptide chloromethyl ketone derivative

SCOP Domain Sequences for d1n6df1:

Sequence; same for both SEQRES and ATOM records:

>d1n6df1 b.36.1.3 (F:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum}
griacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgagsniy
rvlsekagtsarirlsgkggdkrdlmidild

Timeline for d1n6df1:

• d1n6df1 first appeared in SCOP 1.63
  
• d1n6df1 appears in SCOP 1.67
  
• d1n6df1 appears in the current release, SCOPe 2.08