Lineage for d1n6dd3 (1n6d D:320-679)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379749Fold b.69: 7-bladed beta-propeller [50964] (12 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 379909Superfamily b.69.9: Tricorn protease domain 2 [69322] (1 family) (S)
    distorted 7-bladed beta-propeller fold; possibly related to the N-terminal domain of tricorn protease (a 6-bladed beta-propeller)
  5. 379910Family b.69.9.1: Tricorn protease domain 2 [69323] (1 protein)
  6. 379911Protein Tricorn protease domain 2 [69324] (1 species)
  7. 379912Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69325] (4 PDB entries)
  8. 379922Domain d1n6dd3: 1n6d D:320-679 [80139]
    Other proteins in same PDB: d1n6da1, d1n6da2, d1n6da4, d1n6db1, d1n6db2, d1n6db4, d1n6dc1, d1n6dc2, d1n6dc4, d1n6dd1, d1n6dd2, d1n6dd4, d1n6de1, d1n6de2, d1n6de4, d1n6df1, d1n6df2, d1n6df4

Details for d1n6dd3

PDB Entry: 1n6d (more details), 2.8 Å

PDB Description: Tricorn protease in complex with tetrapeptide chloromethyl ketone derivative
PDB Compounds: (D:)

SCOP Domain Sequences for d1n6dd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6dd3 b.69.9.1 (D:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum}
sipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafih
gtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkpt
viersreamitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattensh
dyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsm
tseageydlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvl
lkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplv

SCOP Domain Coordinates for d1n6dd3:

Click to download the PDB-style file with coordinates for d1n6dd3.
(The format of our PDB-style files is described here.)

Timeline for d1n6dd3: