Lineage for d1n6dc1 (1n6d C:763-853)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558451Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 558452Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 558626Family b.36.1.3: Tail specific protease PDZ domain [68933] (2 proteins)
  6. 558633Protein Tricorn protease [69253] (1 species)
  7. 558634Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69254] (4 PDB entries)
  8. 558655Domain d1n6dc1: 1n6d C:763-853 [80133]
    Other proteins in same PDB: d1n6da2, d1n6da3, d1n6da4, d1n6db2, d1n6db3, d1n6db4, d1n6dc2, d1n6dc3, d1n6dc4, d1n6dd2, d1n6dd3, d1n6dd4, d1n6de2, d1n6de3, d1n6de4, d1n6df2, d1n6df3, d1n6df4

Details for d1n6dc1

PDB Entry: 1n6d (more details), 2.8 Å

PDB Description: Tricorn protease in complex with tetrapeptide chloromethyl ketone derivative

SCOP Domain Sequences for d1n6dc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6dc1 b.36.1.3 (C:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum}
griacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgagsniy
rvlsekagtsarirlsgkggdkrdlmidild

SCOP Domain Coordinates for d1n6dc1:

Click to download the PDB-style file with coordinates for d1n6dc1.
(The format of our PDB-style files is described here.)

Timeline for d1n6dc1: