Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.2: Tail specific protease, catalytic domain [52100] (3 proteins) includes N-terminal all-alpha subdomain |
Protein Tricorn protease [69436] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [69437] (4 PDB entries) |
Domain d1n6db4: 1n6d B:680-762,B:854-1061 [80132] Other proteins in same PDB: d1n6da1, d1n6da2, d1n6da3, d1n6db1, d1n6db2, d1n6db3, d1n6dc1, d1n6dc2, d1n6dc3, d1n6dd1, d1n6dd2, d1n6dd3, d1n6de1, d1n6de2, d1n6de3, d1n6df1, d1n6df2, d1n6df3 complexed with chm, d10 |
PDB Entry: 1n6d (more details), 2.8 Å
SCOPe Domain Sequences for d1n6db4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6db4 c.14.1.2 (B:680-762,B:854-1061) Tricorn protease {Thermoplasma acidophilum [TaxId: 2303]} ssiheeflqmydeawklardnywneavakeiseriyekyrnlvplcktrydlsnvivemq geyrtshsyemggtftdkdpfrsXddrfiryrswveanrryvherskgtigyihipdmgm mglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptn svrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqp efafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidalieelrn
Timeline for d1n6db4: