Lineage for d1n6db3 (1n6d B:320-679)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675262Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 675504Superfamily b.69.9: Tricorn protease domain 2 [69322] (1 family) (S)
    distorted 7-bladed beta-propeller fold; possibly related to the N-terminal domain of tricorn protease (a 6-bladed beta-propeller)
  5. 675505Family b.69.9.1: Tricorn protease domain 2 [69323] (1 protein)
  6. 675506Protein Tricorn protease domain 2 [69324] (1 species)
  7. 675507Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69325] (4 PDB entries)
  8. 675521Domain d1n6db3: 1n6d B:320-679 [80131]
    Other proteins in same PDB: d1n6da1, d1n6da2, d1n6da4, d1n6db1, d1n6db2, d1n6db4, d1n6dc1, d1n6dc2, d1n6dc4, d1n6dd1, d1n6dd2, d1n6dd4, d1n6de1, d1n6de2, d1n6de4, d1n6df1, d1n6df2, d1n6df4

Details for d1n6db3

PDB Entry: 1n6d (more details), 2.8 Å

PDB Description: Tricorn protease in complex with tetrapeptide chloromethyl ketone derivative
PDB Compounds: (B:) tricorn protease

SCOP Domain Sequences for d1n6db3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6db3 b.69.9.1 (B:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
sipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafih
gtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkpt
viersreamitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattensh
dyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsm
tseageydlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvl
lkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplv

SCOP Domain Coordinates for d1n6db3:

Click to download the PDB-style file with coordinates for d1n6db3.
(The format of our PDB-style files is described here.)

Timeline for d1n6db3: