Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.3: Tail specific protease PDZ domain [68933] (2 proteins) |
Protein Tricorn protease [69253] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [69254] (4 PDB entries) |
Domain d1n6da1: 1n6d A:763-853 [80125] Other proteins in same PDB: d1n6da2, d1n6da3, d1n6da4, d1n6db2, d1n6db3, d1n6db4, d1n6dc2, d1n6dc3, d1n6dc4, d1n6dd2, d1n6dd3, d1n6dd4, d1n6de2, d1n6de3, d1n6de4, d1n6df2, d1n6df3, d1n6df4 complexed with chm, d10 |
PDB Entry: 1n6d (more details), 2.8 Å
SCOPe Domain Sequences for d1n6da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6da1 b.36.1.3 (A:763-853) Tricorn protease {Thermoplasma acidophilum [TaxId: 2303]} griacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgagsniy rvlsekagtsarirlsgkggdkrdlmidild
Timeline for d1n6da1: