Lineage for d1n6ca2 (1n6c A:194-363)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 303704Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 303846Superfamily b.85.7: SET domain [82199] (3 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 303847Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
    contains metal-binding preSET and postSET domains
  6. 303851Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)
  7. 303852Species Human (Homo sapiens) [TaxId:9606] [82206] (6 PDB entries)
  8. 303859Domain d1n6ca2: 1n6c A:194-363 [80124]
    Other proteins in same PDB: d1n6ca1
    complexed with sam

Details for d1n6ca2

PDB Entry: 1n6c (more details), 2.3 Å

PDB Description: Structure of SET7/9

SCOP Domain Sequences for d1n6ca2:

Sequence, based on SEQRES records: (download)

>d1n6ca2 b.85.7.1 (A:194-363) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens)}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqat

Sequence, based on observed residues (ATOM records): (download)

>d1n6ca2 b.85.7.1 (A:194-363) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens)}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygysppgksgpeapewyqvelkafqat

SCOP Domain Coordinates for d1n6ca2:

Click to download the PDB-style file with coordinates for d1n6ca2.
(The format of our PDB-style files is described here.)

Timeline for d1n6ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n6ca1