SCOP 1.67: Domain d1n6ca1: 1n6c A:79-193

Lineage for d1n6ca1 (1n6c A:79-193)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family)
   11+ stranded sheet partly folded upon itself at the C-end

5. Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)

6. Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82188] (6 PDB entries)

8. Domain d1n6ca1: 1n6c A:79-193 [80123]
   Other proteins in same PDB: d1n6ca2
   truncated from N-terminus
   complexed with sam

Details for d1n6ca1

PDB Entry: 1n6c, 2.3 Å

PDB Description: Structure of SET7/9

SCOP Domain Sequences for d1n6ca1:

Sequence; same for both SEQRES and ATOM records:

>d1n6ca1 b.76.2.1 (A:79-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens)}
ggvlqgtyvdgelngpaqeydtdgrlifkgqykdnirhgvcwiyypdggslvgevnedge
mtgekiayvypdertalygkfidgemiegklatlmsteegrphfelmpgnsvyhf

Timeline for d1n6ca1:

• d1n6ca1 first appeared in SCOP 1.63
  
• d1n6ca1 appears in SCOP 1.65
  
• d1n6ca1 appears in SCOP 1.69
  
• d1n6ca1 appears in the current release, SCOPe 2.08