Lineage for d1n64l1 (1n64 L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741086Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (52 PDB entries)
  8. 2741117Domain d1n64l1: 1n64 L:1-107 [80116]
    Other proteins in same PDB: d1n64h1, d1n64h2, d1n64l2
    part of anti-HCV Fab 19D9D6; complex with peptide, chain P (related to 1cwx)

Details for d1n64l1

PDB Entry: 1n64 (more details), 2.34 Å

PDB Description: Crystal structure analysis of the immunodominant antigenic site on Hepatitis C virus protein bound to mAb 19D9D6
PDB Compounds: (L:) Fab 19D9D6 light chain

SCOPe Domain Sequences for d1n64l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n64l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelk

SCOPe Domain Coordinates for d1n64l1:

Click to download the PDB-style file with coordinates for d1n64l1.
(The format of our PDB-style files is described here.)

Timeline for d1n64l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n64l2