Lineage for d1n64h1 (1n64 H:1-113)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353425Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries)
    Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10
  8. 2353436Domain d1n64h1: 1n64 H:1-113 [80114]
    Other proteins in same PDB: d1n64h2, d1n64l1, d1n64l2
    part of anti-HCV Fab 19D9D6; complex with peptide, chain P (related to 1cwx)

Details for d1n64h1

PDB Entry: 1n64 (more details), 2.34 Å

PDB Description: Crystal structure analysis of the immunodominant antigenic site on Hepatitis C virus protein bound to mAb 19D9D6
PDB Compounds: (H:) Fab 19D9D6 heavy chain

SCOPe Domain Sequences for d1n64h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n64h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvss

SCOPe Domain Coordinates for d1n64h1:

Click to download the PDB-style file with coordinates for d1n64h1.
(The format of our PDB-style files is described here.)

Timeline for d1n64h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n64h2