SCOP 1.71: Domain d1n63f1: 1n63 F:178-286

Lineage for d1n63f1 (1n63 F:178-286)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family)

5. Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)

6. Protein Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain [55449] (2 species)

7. Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [55450] (5 PDB entries)

8. Domain d1n63f1: 1n63 F:178-286 [80112]
   Other proteins in same PDB: d1n63a1, d1n63a2, d1n63b1, d1n63b2, d1n63c2, d1n63d1, d1n63d2, d1n63e1, d1n63e2, d1n63f2
   complexed with cun, fad, fes, mcn, po4

Details for d1n63f1

PDB Entry: 1n63, 1.21 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Carbon monoxide reduced state

SCOP Domain Sequences for d1n63f1:

Sequence; same for both SEQRES and ATOM records:

>d1n63f1 d.87.2.1 (F:178-286) Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
ghgyayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgta
ldkpaldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakara

Timeline for d1n63f1:

• d1n63f1 first appeared in SCOP 1.63
  
• d1n63f1 appears in SCOP 1.69
  
• d1n63f1 appears in SCOP 1.73
  
• d1n63f1 appears in the current release, SCOPe 2.08