Lineage for d1n63c1 (1n63 C:178-287)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259657Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 259777Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family) (S)
  5. 259778Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (3 protein domains)
  6. 259779Protein Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain [55449] (2 species)
  7. 259785Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [55450] (5 PDB entries)
  8. 259790Domain d1n63c1: 1n63 C:178-287 [80106]
    Other proteins in same PDB: d1n63a1, d1n63a2, d1n63b1, d1n63b2, d1n63c2, d1n63d1, d1n63d2, d1n63e1, d1n63e2, d1n63f2

Details for d1n63c1

PDB Entry: 1n63 (more details), 1.21 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Carbon monoxide reduced state

SCOP Domain Sequences for d1n63c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n63c1 d.87.2.1 (C:178-287) Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
ghgyayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgta
ldkpaldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakarak

SCOP Domain Coordinates for d1n63c1:

Click to download the PDB-style file with coordinates for d1n63c1.
(The format of our PDB-style files is described here.)

Timeline for d1n63c1: