Lineage for d1n63b2 (1n63 B:147-809)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262389Fold d.133: Molybdemum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 262390Superfamily d.133.1: Molybdemum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
  5. 262391Family d.133.1.1: Molybdemum cofactor-binding domain [56004] (4 proteins)
  6. 262397Protein Carbon monoxide (CO) dehydrogenase molybdoprotein [56010] (2 species)
  7. 262403Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [56011] (5 PDB entries)
  8. 262408Domain d1n63b2: 1n63 B:147-809 [80105]
    Other proteins in same PDB: d1n63a1, d1n63a2, d1n63b1, d1n63c1, d1n63c2, d1n63d1, d1n63d2, d1n63e1, d1n63f1, d1n63f2

Details for d1n63b2

PDB Entry: 1n63 (more details), 1.21 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Carbon monoxide reduced state

SCOP Domain Sequences for d1n63b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n63b2 d.133.1.1 (B:147-809) Carbon monoxide (CO) dehydrogenase molybdoprotein {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
vdpfkamepdapllredikdkmtgahgarkhhnhifrweigdkegtdatfakaevvskdm
ftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvvslisglpehkihviapd
igggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlsttsfardyhmttelaatkdg
kilamrchvladhgafdacadpskwpagfmnictgsydmpvahlavdgvytnkasggvay
rcsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfpymaplgweydsgnypla
mkkamdtvgyhqlraeqkakqeafkrgetreimgigisffteivgagpskncdilgvsmf
dsaeirihptgsviarmgtksqgqghettyaqiiatelgipaddimieegntdtapyglg
tygsrstptagaatavaarkikakaqmiaahmlevhegdlewdvdrfrvkglpekfktmk
elawasynspppnlepgleavnyydppnmtypfgayfcimdidvdtgvaktrrfyalddc
gtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfmdfflptavetpkwetdy
tvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghiqmphdawrlwkvgeqlg
lhv

SCOP Domain Coordinates for d1n63b2:

Click to download the PDB-style file with coordinates for d1n63b2.
(The format of our PDB-style files is described here.)

Timeline for d1n63b2: