Lineage for d1n63b1 (1n63 B:5-146)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256251Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 256252Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 256253Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (4 proteins)
  6. 256259Protein Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain [54672] (2 species)
  7. 256265Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [54673] (5 PDB entries)
  8. 256270Domain d1n63b1: 1n63 B:5-146 [80104]
    Other proteins in same PDB: d1n63a1, d1n63a2, d1n63b2, d1n63c1, d1n63c2, d1n63d1, d1n63d2, d1n63e2, d1n63f1, d1n63f2

Details for d1n63b1

PDB Entry: 1n63 (more details), 1.21 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Carbon monoxide reduced state
PDB Compounds: (B:)

SCOP Domain Sequences for d1n63b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n63b1 d.41.1.1 (B:5-146) Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
ttveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahari
ksidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvak
dryvaadaielvevdyeplpvl

SCOP Domain Coordinates for d1n63b1:

Click to download the PDB-style file with coordinates for d1n63b1.
(The format of our PDB-style files is described here.)

Timeline for d1n63b1: