Lineage for d1n63a1 (1n63 A:82-162)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 214480Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 214481Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 214482Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (4 proteins)
  6. 214488Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)
  7. 214494Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [47749] (5 PDB entries)
  8. 214499Domain d1n63a1: 1n63 A:82-162 [80102]
    Other proteins in same PDB: d1n63a2, d1n63b1, d1n63b2, d1n63c1, d1n63c2, d1n63d2, d1n63e1, d1n63e2, d1n63f1, d1n63f2

Details for d1n63a1

PDB Entry: 1n63 (more details), 1.21 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Carbon monoxide reduced state
PDB Compounds: (A:)

SCOP Domain Sequences for d1n63a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n63a1 a.56.1.1 (A:82-162) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
apdgtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctg
yqnivkaiqyaaakingvpfe

SCOP Domain Coordinates for d1n63a1:

Click to download the PDB-style file with coordinates for d1n63a1.
(The format of our PDB-style files is described here.)

Timeline for d1n63a1: