Lineage for d1n62f2 (1n62 F:1-177)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512542Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 512543Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 512608Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (4 proteins)
  6. 512609Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species)
  7. 512615Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [56189] (5 PDB entries)
  8. 512617Domain d1n62f2: 1n62 F:1-177 [80101]
    Other proteins in same PDB: d1n62a1, d1n62a2, d1n62b1, d1n62b2, d1n62c1, d1n62d1, d1n62d2, d1n62e1, d1n62e2, d1n62f1

Details for d1n62f2

PDB Entry: 1n62 (more details), 1.09 Å

PDB Description: Crystal Structure of the Mo,Cu-CO Dehydrogenase (CODH), n-butylisocyanide-bound state

SCOP Domain Sequences for d1n62f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n62f2 d.145.1.3 (F:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvppt

SCOP Domain Coordinates for d1n62f2:

Click to download the PDB-style file with coordinates for d1n62f2.
(The format of our PDB-style files is described here.)

Timeline for d1n62f2: