Lineage for d1n62e2 (1n62 E:147-809)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611247Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 611248Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
  5. 611249Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (6 proteins)
  6. 611262Protein Carbon monoxide (CO) dehydrogenase molybdoprotein [56010] (2 species)
  7. 611268Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [56011] (5 PDB entries)
  8. 611270Domain d1n62e2: 1n62 E:147-809 [80099]
    Other proteins in same PDB: d1n62a1, d1n62a2, d1n62b1, d1n62c1, d1n62c2, d1n62d1, d1n62d2, d1n62e1, d1n62f1, d1n62f2
    complexed with cub, fad, fes, mcn, po4

Details for d1n62e2

PDB Entry: 1n62 (more details), 1.09 Å

PDB Description: Crystal Structure of the Mo,Cu-CO Dehydrogenase (CODH), n-butylisocyanide-bound state

SCOP Domain Sequences for d1n62e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n62e2 d.133.1.1 (E:147-809) Carbon monoxide (CO) dehydrogenase molybdoprotein {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
vdpfkamepdapllredikdkmtgahgarkhhnhifrweigdkegtdatfakaevvskdm
ftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvvslisglpehkihviapd
igggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlsttsfardyhmttelaatkdg
kilamrchvladhgafdacadpskwpagfmnictgsydmpvahlavdgvytnkasggvay
rcsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfpymaplgweydsgnypla
mkkamdtvgyhqlraeqkakqeafkrgetreimgigisffteivgagpskncdilgvsmf
dsaeirihptgsviarmgtksqgqghettyaqiiatelgipaddimieegntdtapyglg
tygsrstptagaatavaarkikakaqmiaahmlevhegdlewdvdrfrvkglpekfktmk
elawasynspppnlepgleavnyydppnmtypfgayfcimdidvdtgvaktrrfyalddc
gtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfmdfflptavetpkwetdy
tvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghiqmphdawrlwkvgeqlg
lhv

SCOP Domain Coordinates for d1n62e2:

Click to download the PDB-style file with coordinates for d1n62e2.
(The format of our PDB-style files is described here.)

Timeline for d1n62e2: