Lineage for d1n62d2 (1n62 D:2-81)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1638761Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1638928Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 1638954Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)
  7. 1638960Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [54321] (6 PDB entries)
  8. 1638962Domain d1n62d2: 1n62 D:2-81 [80097]
    Other proteins in same PDB: d1n62a1, d1n62b1, d1n62b2, d1n62c1, d1n62c2, d1n62d1, d1n62e1, d1n62e2, d1n62f1, d1n62f2
    complexed with cub, fad, fes, mcn, po4

Details for d1n62d2

PDB Entry: 1n62 (more details), 1.09 Å

PDB Description: Crystal Structure of the Mo,Cu-CO Dehydrogenase (CODH), n-butylisocyanide-bound state
PDB Compounds: (D:) Carbon monoxide dehydrogenase small chain

SCOPe Domain Sequences for d1n62d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n62d2 d.15.4.2 (D:2-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
akahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvks
ctmfavqangasittiegma

SCOPe Domain Coordinates for d1n62d2:

Click to download the PDB-style file with coordinates for d1n62d2.
(The format of our PDB-style files is described here.)

Timeline for d1n62d2: