Lineage for d1n62b1 (1n62 B:6-146)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256251Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 256252Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 256253Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (4 proteins)
  6. 256259Protein Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain [54672] (2 species)
  7. 256265Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [54673] (5 PDB entries)
  8. 256266Domain d1n62b1: 1n62 B:6-146 [80092]
    Other proteins in same PDB: d1n62a1, d1n62a2, d1n62b2, d1n62c1, d1n62c2, d1n62d1, d1n62d2, d1n62e2, d1n62f1, d1n62f2

Details for d1n62b1

PDB Entry: 1n62 (more details), 1.09 Å

PDB Description: Crystal Structure of the Mo,Cu-CO Dehydrogenase (CODH), n-butylisocyanide-bound state
PDB Compounds: (B:)

SCOP Domain Sequences for d1n62b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n62b1 d.41.1.1 (B:6-146) Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
tveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshaharik
sidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakd
ryvaadaielvevdyeplpvl

SCOP Domain Coordinates for d1n62b1:

Click to download the PDB-style file with coordinates for d1n62b1.
(The format of our PDB-style files is described here.)

Timeline for d1n62b1: