Lineage for d1n62a2 (1n62 A:3-81)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598835Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 598929Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (12 proteins)
  6. 598946Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)
  7. 598952Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [54321] (5 PDB entries)
  8. 598953Domain d1n62a2: 1n62 A:3-81 [80091]
    Other proteins in same PDB: d1n62a1, d1n62b1, d1n62b2, d1n62c1, d1n62c2, d1n62d1, d1n62e1, d1n62e2, d1n62f1, d1n62f2

Details for d1n62a2

PDB Entry: 1n62 (more details), 1.09 Å

PDB Description: Crystal Structure of the Mo,Cu-CO Dehydrogenase (CODH), n-butylisocyanide-bound state

SCOP Domain Sequences for d1n62a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
tmfavqangasittiegma

SCOP Domain Coordinates for d1n62a2:

Click to download the PDB-style file with coordinates for d1n62a2.
(The format of our PDB-style files is described here.)

Timeline for d1n62a2: