Lineage for d1n62a1 (1n62 A:82-163)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 214480Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 214481Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 214482Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (4 proteins)
  6. 214488Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)
  7. 214494Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [47749] (5 PDB entries)
  8. 214495Domain d1n62a1: 1n62 A:82-163 [80090]
    Other proteins in same PDB: d1n62a2, d1n62b1, d1n62b2, d1n62c1, d1n62c2, d1n62d2, d1n62e1, d1n62e2, d1n62f1, d1n62f2

Details for d1n62a1

PDB Entry: 1n62 (more details), 1.09 Å

PDB Description: Crystal Structure of the Mo,Cu-CO Dehydrogenase (CODH), n-butylisocyanide-bound state
PDB Compounds: (A:)

SCOP Domain Sequences for d1n62a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n62a1 a.56.1.1 (A:82-163) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
apdgtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctg
yqnivkaiqyaaakingvpfee

SCOP Domain Coordinates for d1n62a1:

Click to download the PDB-style file with coordinates for d1n62a1.
(The format of our PDB-style files is described here.)

Timeline for d1n62a1: