SCOP 1.63: Domain d1n60f2: 1n60 F:1-177

Lineage for d1n60f2 (1n60 F:1-177)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.145: FAD-binding domain [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding domain [56176] (3 families)

5. Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (3 proteins)

6. Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species)

7. Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [56189] (5 PDB entries)

8. Domain d1n60f2: 1n60 F:1-177 [80077]
   Other proteins in same PDB: d1n60a1, d1n60a2, d1n60b1, d1n60b2, d1n60c1, d1n60d1, d1n60d2, d1n60e1, d1n60e2, d1n60f1
   complexed with fad, fes, mcn, omo, po4

Details for d1n60f2

PDB Entry: 1n60, 1.19 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Cyanide-inactivated Form

SCOP Domain Sequences for d1n60f2:

Sequence; same for both SEQRES and ATOM records:

>d1n60f2 d.145.1.3 (F:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvppt

Timeline for d1n60f2:

• d1n60f2 is new in SCOP 1.63
  
• d1n60f2 appears in SCOP 1.65
  
• d1n60f2 appears in the current release, SCOPe 2.08