Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (3 species) |
Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [54321] (6 PDB entries) |
Domain d1n60d2: 1n60 D:3-81 [80073] Other proteins in same PDB: d1n60a1, d1n60b1, d1n60b2, d1n60c1, d1n60c2, d1n60d1, d1n60e1, d1n60e2, d1n60f1, d1n60f2 complexed with fad, fes, mcn, omo, po4 |
PDB Entry: 1n60 (more details), 1.19 Å
SCOPe Domain Sequences for d1n60d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n60d2 d.15.4.2 (D:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc tmfavqangasittiegma
Timeline for d1n60d2: