SCOPe 2.06: Domain d1n60d2: 1n60 D:3-81

Lineage for d1n60d2 (1n60 D:3-81)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (3 species)

7. Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [54321] (6 PDB entries)

8. Domain d1n60d2: 1n60 D:3-81 [80073]
   Other proteins in same PDB: d1n60a1, d1n60b1, d1n60b2, d1n60c1, d1n60c2, d1n60d1, d1n60e1, d1n60e2, d1n60f1, d1n60f2
   complexed with fad, fes, mcn, omo, po4

Details for d1n60d2

PDB Entry: 1n60, 1.19 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Cyanide-inactivated Form

PDB Compounds: (D:) Carbon monoxide dehydrogenase small chain

SCOPe Domain Sequences for d1n60d2:

Sequence; same for both SEQRES and ATOM records:

>d1n60d2 d.15.4.2 (D:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
tmfavqangasittiegma

Timeline for d1n60d2:

• d1n60d2 first appeared in SCOP 1.63
  
• d1n60d2 appears in SCOPe 2.05
  
• d1n60d2 appears in SCOPe 2.07
  
• d1n60d2 appears in the current release, SCOPe 2.08