Lineage for d1n60d2 (1n60 D:3-81)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254175Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 254256Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (10 proteins)
  6. 254266Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)
  7. 254272Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [54321] (5 PDB entries)
  8. 254276Domain d1n60d2: 1n60 D:3-81 [80073]
    Other proteins in same PDB: d1n60a1, d1n60b1, d1n60b2, d1n60c1, d1n60c2, d1n60d1, d1n60e1, d1n60e2, d1n60f1, d1n60f2
    complexed with fad, fes, mcn, omo, po4

Details for d1n60d2

PDB Entry: 1n60 (more details), 1.19 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Cyanide-inactivated Form

SCOP Domain Sequences for d1n60d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n60d2 d.15.4.2 (D:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
tmfavqangasittiegma

SCOP Domain Coordinates for d1n60d2:

Click to download the PDB-style file with coordinates for d1n60d2.
(The format of our PDB-style files is described here.)

Timeline for d1n60d2: