Lineage for d1n60d1 (1n60 D:82-160)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539215Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 539216Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 539217Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins)
  6. 539230Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)
  7. 539236Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [47749] (5 PDB entries)
  8. 539240Domain d1n60d1: 1n60 D:82-160 [80072]
    Other proteins in same PDB: d1n60a2, d1n60b1, d1n60b2, d1n60c1, d1n60c2, d1n60d2, d1n60e1, d1n60e2, d1n60f1, d1n60f2
    complexed with fad, fes, mcn, omo, po4

Details for d1n60d1

PDB Entry: 1n60 (more details), 1.19 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Cyanide-inactivated Form

SCOP Domain Sequences for d1n60d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n60d1 a.56.1.1 (D:82-160) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
apdgtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctg
yqnivkaiqyaaakingvp

SCOP Domain Coordinates for d1n60d1:

Click to download the PDB-style file with coordinates for d1n60d1.
(The format of our PDB-style files is described here.)

Timeline for d1n60d1: