Lineage for d1n60c2 (1n60 C:1-177)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 335331Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 335332Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 335383Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (3 proteins)
  6. 335384Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species)
  7. 335390Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [56189] (5 PDB entries)
  8. 335393Domain d1n60c2: 1n60 C:1-177 [80071]
    Other proteins in same PDB: d1n60a1, d1n60a2, d1n60b1, d1n60b2, d1n60c1, d1n60d1, d1n60d2, d1n60e1, d1n60e2, d1n60f1

Details for d1n60c2

PDB Entry: 1n60 (more details), 1.19 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Cyanide-inactivated Form

SCOP Domain Sequences for d1n60c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n60c2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvppt

SCOP Domain Coordinates for d1n60c2:

Click to download the PDB-style file with coordinates for d1n60c2.
(The format of our PDB-style files is described here.)

Timeline for d1n60c2: