Lineage for d1n60c1 (1n60 C:178-286)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1422939Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 1423096Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 1423097Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 1423104Protein Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain [55449] (2 species)
  7. 1423110Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [55450] (6 PDB entries)
  8. 1423113Domain d1n60c1: 1n60 C:178-286 [80070]
    Other proteins in same PDB: d1n60a1, d1n60a2, d1n60b1, d1n60b2, d1n60c2, d1n60d1, d1n60d2, d1n60e1, d1n60e2, d1n60f2
    complexed with fad, fes, mcn, omo, po4

Details for d1n60c1

PDB Entry: 1n60 (more details), 1.19 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Cyanide-inactivated Form
PDB Compounds: (C:) Carbon monoxide dehydrogenase medium chain

SCOPe Domain Sequences for d1n60c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n60c1 d.87.2.1 (C:178-286) Carbon monoxide (CO) dehydrogenase flavoprotein, C-terminal domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
ghgyayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgta
ldkpaldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakara

SCOPe Domain Coordinates for d1n60c1:

Click to download the PDB-style file with coordinates for d1n60c1.
(The format of our PDB-style files is described here.)

Timeline for d1n60c1: